İGF1-LR3 Nedir ve Ne İşe Yarar ?

İGF1-LR3 Nedir ve Ne İşe Yarar?

İGF1-LR3 (Uzun R3 İnsülin Benzeri Büyüme Faktörü), insüline benzer özelliklere sahip bir polipeptid hormondur. Bununla birlikte, LR3, yarılanma ömrünü arttırmak ve protein bağlanmasından dolayı deaktivasyonu önlemek için modifiye edilmiş bir IGF1 formudur. IGF1 LR3, 83 konumunda Glutamik asit yerine Arginin ikame edilerek 83 amino asit içerir. Değiştirilen polipeptid dizisi, protein bağlanmasını önler ve yarı ömrü artırır. Biyomolekül, protein biyosentezine yardımcı olmak için glikoz ve amino asitler hücrelere taşınmasının yanı sıra yağ metabolize edici özelliklere sahiptir. Araştırma bulguları, IGF1 LR3’ün kas hücresi hiperplazisini teşvik ettiğini, hücrelerdeki nöro-fonksiyonları ve azot retansiyonunu artırdığını ortaya koymaktadır. IGF1 LR3’ün molekül ağırlığı ve molekül kütlesi sırasıyla 9.200 ve C990H1528N262O300S7’dir.

İGF1-LR3 Nedir ve Ne İşe Yarar

IGF-1 LR3, IGF kategorisinde pek çok büyüme faktörünün nitrojen tutulumu yoluyla protein oluşumunu arttırmasına izin verir. Uzun versiyon orijinal IGF-1’den daha etkilidir; Artan bağlanma siteleri nedeniyle gelişmiş bir potensiteye sahiptir. Hormon, hiperplaziyi arttırmada etkilidir, yeni kas hücrelerinin bölünmesi ve oluşumundaki faaliyeti ile yaygın şekilde bilinir. IGF-1 LR3, doğal insülin benzeri büyüme faktörünün sentetik bir versiyonudur ancak pozisyon numarası 3’de modifikasyona ve B terminalinde 13 numaralı amino asit numarasında bir uzantıya sahiptir.

İnsülin benzeri büyüme faktörü 1’den daha etkilidir. Ayrıca, araştırmalar IGF-1’den daha uzun yarılanma ömrüne sahip olduğunu, polipeptitin kas yenilenmesinde hayati bir rol oynadığını ve kök hücrelerin üretimini ve diferansiyasyonunu teşvik ettiğini ortaya koymaktadır. IGF-1 LR3’ün, hücrelerin uydu aktivitesini, kas protein içeriğini, kas DNA’sını ve kas kesit alanı ve kas ağırlığını arttırdığı bilinmektedir. Polipeptidin özü, hiperplaziyi arttırarak kas büyümesine neden olduğu gerçeğidir.

Peptidin ilkel formu, konformasyonel yapı nedeniyle sıklıkla oluşan doğal amino asit sekansına karşılık gelir ve peptid Escherichia coli kullanılarak üretilir. Ekstraksiyon işleminden sonra, İGF1-LR3 yapmak için proteini katlamak ve saflaştırmak için çok sayıda saflaştırma ve kromatografik teknikler kullanılır; bu, polipeptitin yüksek potent ve fonksiyonel bir formudur ve birkaç IGF-1 reseptörüne bağlanabilir. IGF-1 veya insülin benzeri büyüme faktörü 1, IGF-1 geni tarafından transkripsiyonel olarak kodlanmış bir peptid hormondur ve ana üretim merkezi karaciğer hücreleri veya hepatosittir.

Hareket mekanizması

Büyüme hormonu, teknik açıdan hepatositlerden bu hormonun üretimi hakkında olumlu bir geribildirim sahibidir, İGF1-LR3 dizisinde 70 amino asitten oluşur ve dizide üç molekül içi disülfür köprüsü vardır. Peptid moleküler konfigürasyonu ve insülinin yapısını paylaşır; Vücuda anabolik etkiler yapar. Igf-1’in satın alınmasının hedef konular ve reseptörler üzerinde moleküler etkileşimi başlatmak için otokrin ve parakrin sinyalizasyon şelalelerini kullandığı yaygın olarak bilinir. Araştırmaya göre, IGF-1peptid sülfasyona neden olabilir ve bu da baskılanmayan insülin benzeri aktiviteye veya NSILA’ya neden olabilir.

Modern bilim dünyasında insülin büyüme faktörü 1 sıklıkla somatomedin C olarak adlandırılır. IGF-1’in aktivitesine, farklı hücrelerde bulunan insülin benzeri büyüme faktörü 1 reseptörü aracılık eder. Diferansiyel araştırma, İGF1-LR3 veya insülin benzeri büyüme faktörü 1 reseptörünün, tirozin kinaz reseptör ailesi altında sınıflandırıldığını gösterir. Ligandın hücre içi Akt sinyal yolunu bağladığını ve aktive ettiğini ve terminal akış aşağı etkilerinde hücresel ölüm veya apoptozun inhibisyonu ve hücre proliferasyonunun, hücre bölünmesinin, hücrenin gelişiminin ve olgunluğun uyarılmasının sayılması önemlidir.

Bu Makalede İlginizi Çekebilir   Balkan Pharma Clenbuterol Nedir ?

İGF1-LR3 nedir?

İGF1-LR3 (Uzun R3 İnsülin Benzeri Büyüme Faktörü), insüline benzer özelliklere sahip bir polipeptid hormondur. Bununla birlikte, LR3, yarılanma ömrünü artırmak ve protein bağlanmasından kaynaklanan etkisizleştirmeyi önlemek için modifiye edilmiş bir IGF1 formudur. IGF1 LR3, 83 pozisyonunda Glutamik asit yerine Arginin ikamesiyle 83 amino asidi içerir. Değiştirilen polipeptit sekansı protein bağlanmasını önler ve yarı ömrü artırır. Biyomoleküller, protein biyosentezine yardımcı olmak için glikoz ve amino asitler hücrelere taşınmasının yanı sıra yağ metabolize edici özelliklere sahiptirler. Araştırma bulguları, IGF1 LR3’ün kas hücresi hiperplazisini teşvik ettiğini, hücrelerdeki nöro-fonksiyonları ve azot retansiyonunu artırdığını ortaya koymaktadır. IGF1 LR3’ün molekül ağırlığı ve molekül kütlesi sırasıyla 9.200 ve C990H1528N262O300S7’dir.

IGF-1 LR3, IGF kategorisinde pek çok büyüme faktörünün nitrojen tutulumu yoluyla protein oluşumunu arttırmasına izin verir. Uzun versiyon orijinal IGF-1’den daha etkilidir; Artan bağlanma siteleri nedeniyle gelişmiş bir potensiteye sahiptir. Hormon, hiperplaziyi arttırmada etkilidir, yeni kas hücrelerinin bölünmesi ve oluşumundaki faaliyeti ile yaygın şekilde bilinir. İGF1-LR3 doğal insülin benzeri büyüme faktörünün sentetik bir versiyonudur, ancak pozisyon numarası 3’de modifikasyona ve B terminalinde 13 numaralı amino asit numarasında bir uzantıya sahiptir. İnsülin benzeri büyüme faktörü 1’den daha güçlüdür. Ayrıca araştırmalar, IGF-1’den daha uzun bir yarı ömre sahip olduğunu, polipeptitin kas yenilenmesinde hayati bir rol oynadığını ve kök hücrelerin üretimini ve diferansiyelini teşvik ettiğini ortaya koymaktadır. IGF-1 LR3’ün, hücrelerin uydu aktivitesini, kas protein içeriğini, kas DNA’sını ve kas kesit alanı ve kas ağırlığını arttırdığı bilinmektedir. Polipeptidin özü, hiperplaziyi arttırarak kas büyümesine neden olduğu gerçeğidir.

İnsülin benzeri büyüme faktörü 1, IGF-1 geni ile transkripsiyon sırasında kodlanan bir peptid hormondur. Bu önemli bir gen, çünkü hücre bölünmesi, gelişimi ve onarımı gerçekleşemediği için. Çalışmalar, IGF-1’in karaciğer hücreleri veya hepatositler üzerinde bulunduğunu ortaya koyuyor. Büyüme hormonu, hepatositlerden insülin benzeri büyüme faktörü 1 üretimi üzerinde olumlu bir etkiye sahiptir. Teknik açıdan bakıldığında, yetmiş amino asit peptidi yeni hücrelerin üretilmesinde önemlidir ve bu doku onarımı için hayati önem taşımaktadır.

Daha önce belirtildiği gibi insülin benzeri büyüme faktörü 1 yetmiş amino asitten oluşur ve bu amino asitler disülfür köprüleri vasıtasıyla bağlanır. Peptidin moleküler konfigürasyonu insülininkine benzer ve araştırmalar, vücuda anabolik etkileri olduğunu gösteriyor. Bu peptid moleküler etkileşimleri başlatmak için parakrin ve otokrin sinyalleme kaskadlarında kullanılır ve bu da alıcıları ve dokuları hedef alır. Çeşitli araştırmalardan elde edilen bulgular, sülfasyon indükleme kabiliyetine sahip olduğunu ve bunun insülin benzeri büyüme faktörü 1 düzeylerini etkilemeyeceğini göstermektedir. İnsülin benzeri büyüme faktörü 1’in nasıl çalıştığını anlamak, peptitin doğru konfigürasyonda sunulmasında önemlidir ve bu yardımcı olacaktır işlevselliği nasıl uyguladığını anlamışsındır.

Araştırmalar, insülin benzeri büyüme faktörü 1’in, hipofiz bezinden büyüme hormonu üretimini artırmada hayati önem taşıdığını ve insülin reseptörlerinin sensitizasyonunu arttırdığı için metabolizmanın teşvik edilmesinde büyük önem taşıdığını gösteriyor. İnsülin reseptörleri duyarlı hale getirildiğinde, peptidin büyüme hormonu ve diğer faktörlere olan tepkisini arttırırlar. Buna ek olarak, araştırmalar, yağ katabolizmasının, peptidin bir uygulaması ile geliştirildiğini göstermektedir. Yağların katabolizması, visseral ve periferik organlarda depolanan tahrip edici ve aşırı yağların boşaltım veya enerji üretimindeki kullanımlar için bozulduğu bir işlemi ifade eder. Enerji serbest bırakıldıktan sonra vücut sistemlerinin işlevlerini hücre, doku ve organlardan zenginleştirir. Dahası, çalışmalar, peptidin, miyoblastik farklılaşmayı ve çalışma mekanizmasını arttırarak yağsız kasları teşvik etmesinde önemli olduğunu ortaya koymaktadır.

Bu Makalede İlginizi Çekebilir   Pharmacom Labs Oxandrolonos (Anavar) Laboratuar Testi

IGF-1 LR 3, protein sentezini arttırma kabiliyetine sahiptir; bu, herhangi bir araştırmada çok önemlidir ve yağsız vücut kitlesi ile birleştiğinde, miyositlerin çoğalmasında artış önemlidir. Miyosit çoğalması önemlidir çünkü kas hücrelerinin genişlemesi ile karakterize edilen kas atrofisi veya hipertrofi şansını azaltmaya yardımcı olur. Bazı durumlarda bu kaslar büyüdüğünde kontrol edilemez hale gelir ve hücrelere zarar verir ve kırılmaya neden olur. Sistemdeki toplam yağ miktarı, sistemdeki insülin benzeri büyüme faktörü 1 varlığına bağlıdır. Farklı araştırma çalışmaları, bu peptidin reseptörlerinin tirozin kinaz aile reseptörleri altında sınıflandırıldığını göstermektedir. Ligandın bağlanmasının hücre içi Akt sinyal yolunu ve hücresel ölüm veya apoptozu içeren diğer aşağı akış etkilerini aktive etmede hayati önem taşıdığını not etmek hayati önem taşır. Buna ek olarak çoğalmayı, hücre bölünmesini, hücre gelişimini ve olgunlaşmayı artırmada etkilidir. Hücre farklılaşması ve olgunluğu önemli bir unsurdur, çünkü büyüme ve gelişme olmadan gerçekleşmez.

Son yıllardaki araştırmalar, IGF-1 LR3’ün büyüme hormonu aktivitelerine aracılık etmede işlevsel olduğunu ve ergenlik döneminde hormonun üretildiğinde işlevsel olduğunu ortaya koymaktadır. Hücrenin, dokuların ve organların büyümesi ve gelişiminin desteklenmesinde hayati bir rol oynar. Az miktarda İGF1-LR3 üretimi veya üretimi yetersizliği, büyümenin durması veya boyunun azalmasına neden olur. Araştırmada kullanılan çeşitli modeller vardır ve IGF, yeni bir araştırma çalışmasına göre büyümeyi ve gelişmeyi artıran en iyi peptiddir. Bazı durumlarda, araştırmacılar büyüme hormonu üretimini teşvik etmek için diğer terapilerle birlikte kullanmışlardır ve bu araştırma ve geliştirme için iyi bir yol sunmaktadır. Araştırmalar, insülin benzeri büyüme faktörü 1’in nükleotid sentezini arttırmada ve nöronal büyümenin arttırılmasında hayati olduğunu gösteriyor. Dahası, terapötikler, bu peptitin kombine bir versiyonunun periferik nöropatiler de dahil olmak üzere çeşitli rahatsızlıklarla mücadelede motor aksonların dejenerasyonuna yol açan şart olduğunu göstermektedir.

Araştırmalar, insülin benzeri büyüme faktörü 1’in, doğal olarak üretilen IGF-1 ile ekzojen hormon arasındaki benzerliklerin anlaşılmasında yaşamsal olduğunu göstermektedir. Belgelenmiş araştırmalar, IGF-1 LR 3’ün artan amino asit üretimi ve vücudun farklı hücrelerine glikoz taşınması üzerinde yukarı düzenleyici etkilere sahip olduğunu ve bunun ribonükleik asit sentezini arttırırken protein bozunmasını inhibe ettiğini gösteriyor. Özünde, bir sistemdeki toplam protein hücresi miktarı büyük bir farkla arttırılır. Buna ek olarak, hipertrofi, hücrelerin hızla çoğalmasıyla diğer kompleks hücre bölünmeleri arasında metastaza neden olan bir kavramdır. İnsülin benzeri büyüme faktörü 1’in verilmesinin hücresel hipertrofinin etkilerini azalttığı ve düzenlenmiş bir hücre bölünmesine yardımcı olabileceği görülmektedir.

Hücresel bozulmayı önlemeyi amaçlayan çok sayıda çalışma yapılmıştır ve yaygın yöntemlerden birisi insülin benzeri büyüme faktörü 1’in uygulanmasıdır. Güncel araştırmalar çoğunlukla biyolojik bir sistemde uzun süre yaşayabilen peptitlerin herhangi bir aşınma ve yıpranma olmadan üretilmesine odaklanmıştır . Ek olarak, etkilerini gösterebilir, insülin benzeri büyüme faktörü 1’in yarılanma ömrü on dört dakikadan azdır ve sentetik versiyon yaklaşık 24-30 saattir. Yarılanma ömründe bir artış, peptidin biyoyararlanımının, peptid dağılımı devam ettirildiğinde bile değişmediği anlamına gelir. Peptid araştırmasında endişe kaynağı olan ana alan biyoyararlanımdır; Çoğu durumda, peptidler bozulmaya uğrarlar, burada proteazlar gibi hücresel enzimler, diğerlerinin yanı sıra enzimlerin bozunmasına neden olurlar. Son yıllardaki araştırmalar, peptitin metabolizma üzerine etkileri olduğunu ve araştırma sonuçlarına göre metabolizmayı arttırdığını, bu nedenle kilo kaybının oluştuğunu gösteriyor. Araştırmanın temel amacı, sentetik insülin benzeri büyüme faktörünün kilo kaybını arttırmada nasıl çalıştığını anlamaktı.

Bu Makalede İlginizi Çekebilir   HGH Frag 176-191 Yan Etkileri - Zararları Nelerdir ?

Düvelanlar peptide tabi tutuldu ve kilo vermek için kasten azaltıldılar. Birkaç hafta sonra düveler kilo verdi ve araştırmacıların farklı yönlerden bulgular elde etmesine izin vermek için ikiye ayrıldılar. İnsülin benzeri büyüme faktörü 1, daha sonra intravenöz olarak uygulandı ve oldukça uzun bir süre sonra, test grubu, iskelet ve kas proteininde herhangi bir etki göstermedi; buna ek olarak, artmış bir amino asit ve plazma konsantrasyonu gösterdi. Plasebo, insülin benzeri büyüme faktörü 2’nin düzenli bir konsantrasyonunu korudu. İnsülin benzeri büyüme faktörü 1’in artmış protein retansiyonuna katkıda bulunduğunu ve bağlayıcı proteinlerin daha iyi protein üretimi sağladığını not etmek zorunludur. Aterosklerozun stabilizasyonunda insülin benzeri büyüme faktörü 1’in rolünü belirlemeye yönelik çeşitli araştırmalar yapılmıştır ve bu düz kas tipi fenotipin değişimi yoluyla yapılmıştır. Araştırmada, deneklerde kullanılan farelere insülin benzeri büyüme faktörü 1 uygulanmış, bunlar makrofaj şartlandırılmış ve M1 polarize edilmiştir. Aterosklerozun önlenmesinde negatif geribildirim sinyal sistemi, etkileşimin önemli bir alanıdır.

Çalışmaya göre, insülin benzeri büyüme faktörü 1 bağlayıcı protein 3’ün up-regülasyonu vardı ve çeşitli dokuların ablasyonuyla sonuçlandı. Buna ek olarak, araştırma ortamı col 3 al ve aktin genleri üzerinde engelleyici etkilere sahipti, bununla birlikte, bu araştırma ortamında matris bozucu enzimler yukarı regüle edildi. Çalışmadan elde edilen sonuçlar, insülin benzeri büyüme faktörü 1 LR3’ün aterosklerotik plağı önlemede net bir pozitif etkiye sahip olduğunu ortaya koymaktadır.

Tavsiye edilen IGF-1 LR 3 Dozajı nedir ve nasıl kullanılır ?

Tavsiye edilen dozaj döngüsü test konusuna bağlı olarak günde 20-60 mg arasında kullanılır. Araştırmanızın amacını belirlemeniz ve herhangi bir araştırmaya başlamadan önce ne beklediğinizi anlamanız önemlidir. Üstelik, bu peptidin uygulanması elli gün süreyle devam ettirilmeli ve herhangi bir etki görülmesi için peptit verilmesi düzenli olmalıdır. Bununla birlikte, pazarda temin edilen peptidler yalnızca araştırma amaçlıdır ve insan tüketimine izin verilmemektedir. Peptid kalitesi ve saflığı, araştırma ve geliştirmede önemli bir rol oynadığından, araştırma için peptid tedarik etmek için saygın bir tedarikçi seçmeniz hayati önem taşımaktadır.

İGF1-LR3 Kimyasal Profili

CAS: 946870-92-4

Formül: C990H1528N262O300S7

Molekül ağırlığı: 9200

Peptit saflığı:>% 99.0

Zincir: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA

 

No votes yet.
Please wait...


Bir Cevap Yazın

E-posta hesabınız yayımlanmayacak. Gerekli alanlar * ile işaretlenmişlerdir